PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00493_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 587aa    MW: 63147.7 Da    PI: 6.5132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00493_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-16137185148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48 
                      rg+WT+eEd  l+d+v+++G+++W++++ + g  +R++k+c++r+ ++l
    kfl00493_0040 137 RGPWTKEEDAMLADYVQRFGPKDWSSVPMKTGlVNRCGKSCRLRYVNHL 185
                      89*******************************************9986 PP

2Myb_DNA-binding41.43.3e-13191234146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +++ +E++  +++ +qlG++ W++Ia+ m+ gRt++++k+ w++
    kfl00493_0040 191 KEAFSDDEEQMVIHLQAQLGNK-WAAIAAQMP-GRTDNEIKNLWNT 234
                      5689******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.143132185IPR017930Myb domain
SuperFamilySSF466891.05E-26134232IPR009057Homeodomain-like
SMARTSM007177.3E-14136187IPR001005SANT/Myb domain
PfamPF002492.2E-14137185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-21138192IPR009057Homeodomain-like
CDDcd001672.02E-10139185No hitNo description
PROSITE profilePS5129422.08186240IPR017930Myb domain
SMARTSM007173.1E-11190238IPR001005SANT/Myb domain
PfamPF002491.6E-11191234IPR001005SANT/Myb domain
CDDcd001679.40E-9193234No hitNo description
Gene3DG3DSA:1.10.10.605.8E-21193239IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MEEAKPPVAQ CGSPNTVLDP AAFFQEQRVV AKAQASQLYQ LDPTICNPIS LPAAGQLAGR  60
LYPGGQVKLS APMLAQVQAR GMHNVASHGG LVGGHHRPGQ VHTRSYQTRE QSQQSSSGAD  120
EEVGLGGSTI GPDGLKRGPW TKEEDAMLAD YVQRFGPKDW SSVPMKTGLV NRCGKSCRLR  180
YVNHLRPNLK KEAFSDDEEQ MVIHLQAQLG NKWAAIAAQM PGRTDNEIKN LWNTRIKKRK  240
RDAELHGLDM QPQQLYRWPQ AARPAYSEGD NGMPPLVSVE EWGGRVGRGA RRMIGPHSNV  300
RRAASLPPDA GAYVYIPEGP ACLAPPAASS TTCPSGPRPP SAQSCRSRLS NSTRAVSSDG  360
VNDSKSVGWS PIEEAMFCAP TTSQEHTLLS PSPEDQLMVV PPDESVELPG GEQHFVPPKQ  420
EELPAMPDEI IDDGSGGPEP STSYSLEDDK MFQRKAFIDK LRLDAGGGVH WAASLDTNSS  480
LEGGPSTARL NPPGSDTPAW TPSSGTFPSF LRASTPKARD SCRTPGFPNP FTPGPSFAFP  540
SMCETPLGGG SSFDVFPSPA GYQKTVKSVT DEMMAEDDVA RLSRTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-2913523925127MYB TRANSFORMING PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-43myb domain protein 101